PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.303380.1
Common NameCsa_5G152860, LOC101215049
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family TALE
Protein Properties Length: 607aa    MW: 66963.8 Da    PI: 6.4793
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.303380.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox27.26.7e-093353721954
                     HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     Fe   ++yps  ++  LA+++gL+ +qV++WF N R +
  Cucsa.303380.1 335 FEHflHPYPSDVDKHILARQTGLSRSQVSNWFINARVR 372
                     554459******************************88 PP

2BELL111.83.9e-36197267272
            BELL   2 rqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     ++elqk+k+kL s+leeV++rY++y+eq+++v++sFeavag g+a++Y +lA+ka+SrhFr+Lkd i++qi
  Cucsa.303380.1 197 FMELQKRKTKLFSMLEEVERRYRHYCEQMKAVVASFEAVAGSGAARVYSALASKAMSRHFRSLKDGIVGQI 267
                     689******************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.6E-51143265IPR006563POX domain
PfamPF075262.1E-41149263IPR006563POX domain
PROSITE profilePS5007112.179313376IPR001356Homeobox domain
CDDcd000865.73E-12316377No hitNo description
SMARTSM003895.8E-9316380IPR001356Homeobox domain
SuperFamilySSF466894.71E-17317383IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.1E-27319382IPR009057Homeodomain-like
PfamPF059208.0E-18333372IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0009506Cellular Componentplasmodesma
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 607 aa     Download sequence    Send to blast
MAGELCEGEG KSNEMVVGGE FYYNSNSNSN NIPNQFTNQI QTGFGSTTEP AVVEMFNNES  60
SGGGGGGGGG DDDESFPQNM MVVGPWGTTA TTDSSLRCVF PCEPNERPSQ GLSLSLSSSN  120
PSSIGLQSFE LRQQHQQQQN QSSFPIFHLR NSKFLAPTQE LLYEFCSLGI TNHSSSSPKH  180
KHPSSSSTNF SLHSLDFMEL QKRKTKLFSM LEEVERRYRH YCEQMKAVVA SFEAVAGSGA  240
ARVYSALASK AMSRHFRSLK DGIVGQIQAT RKAMGEKDPI APGTTRGETP RLRVIDQALR  300
QQRAFHQISI MESHPWRPQR GLPERSVSVL RAWLFEHFLH PYPSDVDKHI LARQTGLSRS  360
QVSNWFINAR VRLWKPMVEE MYLEETKEQE EEIDNSFNNN ANNSFDGVTD FNDDIDGHRS  420
IATRLEDQKP TPDQLLRIDS ECLSSIISSN SEKNNDHSRT IKTMQNHHGH QLHGNHNHTF  480
GRVVGDAFGT VELDFSSYNH HTGSGGVSYH NSSHNNNNQH FNNGSGGGVS LTLGLQQHAA  540
AGGNGNGGVS IAFASAGPAV GQNSLFFTRD HMEECQPVQY SLLDGETQNL PYRNLMGAQL  600
LHDLAG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrm_A5e-16322380563Homeobox protein Meis2
4xrm_B5e-16322380563Homeobox protein Meis2
4xrs_A4e-16322379158Homeobox protein Meis1
4xrs_B4e-16322379158Homeobox protein Meis1
5bng_A5e-16322380159Homeobox protein Meis2
5bng_B5e-16322380159Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818950.0LN681895.1 Cucumis melo genomic scaffold, anchoredscaffold00005.
GenBankLN7132630.0LN713263.1 Cucumis melo genomic chromosome, chr_9.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011654729.10.0PREDICTED: homeobox protein BEL1 homolog
SwissprotQ388971e-147BEL1_ARATH; Homeobox protein BEL1 homolog
TrEMBLA0A0A0KQV00.0A0A0A0KQV0_CUCSA; Uncharacterized protein
STRINGPOPTR_0001s09720.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF46502030
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G41410.11e-101TALE family protein
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]